nicht mehr verfügbar

H00054551-B01P MAGEL2 Antikörper

See related secondary antibodies

Search for all "MAGEL2"

Kurzübersicht

Mouse anti Human MAGEL2

H00054551-B01P

Produktbeschreibung für MAGEL2

Mouse anti Human MAGEL2.
Product is tested for Western blot / Immunoblot.

Produktdaten von MAGEL2

Produkt-Kategorie Primärantikörper
Menge 0.5 mg
Synonyme NDNL1, nM15
Reaktivität Hu
Anwendungen WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Worldwide
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q6P3U4
Immunogen:
MAGEL2 (AAI67825.1, 1 a.a. ~ 646 a.a) full-length human protein.
AA Sequence:
MEFQEVQQTQALAWQAQKAPTHIWQPLPAQEAQRQAPPLVQLEQPFQGAPPSQKAVQIQLPPQQAQASGPQAEVPT LPLQPSWQAPPAVLQAQPGPPVAAANFPLGSAKSLMTPSGECRASSIDRRGSSKERRTSSKERRAPSKDRMIFAAT FCAPKAVSAARAHLPAAWKNLPATPETFAPSSSVFPATSQFQPASLNAFKGPSAASETPKSLPYALQDPFACVEAL PAVPWVPQPNMNASKASQAVPTFLMATAAAPQATATTQEASKTSVEPPRRSGKATRKKKHLEAQEDSRGHTLAFHD WQGPRPWENLNLSDWEVQSPIQVSGDWEHPNTPRGLSGWEGPSTSRILSGWEGPSASWALSAWEGPSTSRALGLSE SPGSSLPVVVSEVASVSPGSSATQDNSKVEAQPLSPLDERANALVQFLLVKDQAKVPVQRSEMVKVILREYKDECL DIINRANNKLECAFGYQLKEIDTKNHAYIIINKLGYHTGNLVASYLDRPKFGLLMVVLSLIFMKGNCVREDLIFNF LFKLGLDVRETNGLFGNTKKLITEVFVRQKYLEYRRIPYTEPAEYEFLWGPRAFLETSKMLVLRFLAKLHKKDPQS WPFHYLEALAECEWEDTDEDEPDTGDSAHGPTSRPPPR
GeneID:
54551
Add. information Mouse polyclonal antibody raised against a full-length human MAGEL2 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn