nicht mehr verfügbar

NBP1-94030 MAP7D3 Antikörper

See related secondary antibodies

Search for all "MAP7D3"

Kurzübersicht

Rabbit anti Human MAP7D3

NBP1-94030

Mehr Bilder

  • NBP1-94030

Produktbeschreibung für MAP7D3

Rabbit anti Human MAP7D3.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections.

Produktdaten von MAP7D3

Produkt-Kategorie Primärantikörper
Menge 0.1 ml
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen ICC/IF, P
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q8IWC1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EADNEESDKDSLNEMFPSAILNGTGSPTKFKMPFNNAKKMTHKLVFLEDGTSQVRKEPKTYFNGDLKNFRQKSMKDTSIQEVVSRPSSKRMTSH
GeneID:
79649
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 79649

Accessory Products

Proteins and/or Positive Controls

Positive controls for MAP7D3 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

MAP7D3 overexpression lysate

MAP7D3 overexpression lysate
0.1 mg / 495,00 €
  OriGene Technologies, Inc.
  • LinkedIn