nicht mehr verfügbar

H00004212-M02A MEIS2 Antikörper

See related secondary antibodies

Search for all "MEIS2"

Kurzübersicht

Mouse anti Human MEIS2 1B3

Produktbeschreibung für MEIS2

Mouse anti Human MEIS2 1B3.
Presentation: Ascites
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Produktdaten von MEIS2

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.2 ml
Synonyme Homeobox protein Meis2
Präsentation Ascites
Reaktivität Hu
Anwendungen E, WB
Klonalität Monoclonal
Klon 1B3
Wirt Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
O14770
Immunogen:
MEIS2 (AAH01516, 1 a.a. ~ 382 a.a) full-length recombinant protein with GST tag.
AA Sequence:
MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLL ALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVH ELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHA SQSGDNSSEQGDGLDNSVASPGTGDDD
GeneID:
4212
Remarks:
Gene Accession: BC001516
Add. information Mouse monoclonal antibody raised against a full-length recombinant MEIS2.

Antibody Reactive Against Recombinant Protein.
Anwendung ELISA,WB-Ce,WB-Re
Storage In ascites fluid
Format
Label:
None
Purification:
Ascites
Buffer System:
In ascites fluid
Purity:
Ascites
State:
Ascites
Specificity
Species:
Human
Gene ID 4212

Accessory Products

Proteins and/or Positive Controls

Proteine zu MEIS2 (5 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

MEIS2 (transcript variant f)

MEIS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

MEIS2 (transcript variant d)

MEIS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

MEIS2 (transcript variant a)

MEIS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

MEIS2

MEIS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MEIS2

MEIS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MEIS2 (4 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

MEIS2 293T Cell Transient Overexpression Lysate(Denatured)

MEIS2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MEIS2 Lysate

Western Blot: MEIS2 Lysate [NBL1-13002] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MEIS2
  Novus Biologicals Inc.

MEIS2 Lysate

Western Blot: MEIS2 Lysate [NBL1-13003] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MEIS2
  Novus Biologicals Inc.

MEIS2 Lysate

Western Blot: MEIS2 Lysate [NBL1-13004] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MEIS2
  Novus Biologicals Inc.
  • LinkedIn