TA337289 MEIS2 Antikörper

Rabbit Polyclonal Anti-MEIS2 Antibody

See related secondary antibodies

Search for all "MEIS2"

0.1 ml / 300,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MEIS2

TA337289

Mehr Bilder

  • TA337289

Produktbeschreibung für MEIS2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish MEIS2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Produktdaten von MEIS2

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme Homeobox protein Meis2
Präsentation Purified
Reaktivität Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Anwendungen P, WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
O14770
Immunogen:
The immunogen for anti-MEIS2 antibody: synthetic peptide directed towards the N terminal of human MEIS2. Synthetic peptide located within the following region: HYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELA.
GeneID:
4212
Anwendung WB
IHC
Background MEIS2 encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu MEIS2 (5 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

MEIS2 (transcript variant f)

MEIS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

MEIS2 (transcript variant d)

MEIS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

MEIS2 (transcript variant a)

MEIS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

MEIS2

MEIS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MEIS2

MEIS2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MEIS2 (4 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

MEIS2 293T Cell Transient Overexpression Lysate(Denatured)

MEIS2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MEIS2 Lysate

Western Blot: MEIS2 Lysate [NBL1-13002] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MEIS2
  Novus Biologicals Inc.

MEIS2 Lysate

Western Blot: MEIS2 Lysate [NBL1-13003] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MEIS2
  Novus Biologicals Inc.

MEIS2 Lysate

Western Blot: MEIS2 Lysate [NBL1-13004] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MEIS2
  Novus Biologicals Inc.
  • LinkedIn