nicht mehr verfügbar

NBP1-55180 METTL7B Antikörper

See related secondary antibodies

Search for all "METTL7B"

Kurzübersicht

Rabbit anti Human METTL7B

Produktbeschreibung für METTL7B

Rabbit anti Human METTL7B.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von METTL7B

Produkt-Kategorie Primärantikörper
Menge 50 µg
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Shipping to Europe only
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
A8K247
Immunogen:
Synthetic peptides corresponding to METTL7B(methyltransferase like 7B) The peptide sequence was selected from the middle region of METTL7B. Peptide sequence FVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLF.
GeneID:
196410
Background METTL7B belongs to the methyltransferase superfamily. It is a probable methyltransferase.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 196410

Accessory Products

  • LinkedIn