nicht mehr verfügbar

H00403312-B01P MGC39545 Antikörper

See related secondary antibodies

Search for all "MGC39545"

Kurzübersicht

Mouse anti Human MGC39545

H00403312-B01P

Produktbeschreibung für MGC39545

Mouse anti Human MGC39545.
Product is tested for Western blot / Immunoblot.

Produktdaten von MGC39545

Produkt-Kategorie Primärantikörper
Menge 0.5 mg
Synonyme -
Reaktivität Hu
Anwendungen WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Worldwide
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q8IYB0
Immunogen:
MGC39545 (AAH36197.1, 1 a.a. ~ 196 a.a) full-length human protein.
AA Sequence:
MPSGEERRDRQKGRRAGCDTSSTPSNTAPRIPEPGAHPTAARPATAQPPRSLLPPVCSKTIAPPASAAAASGSDTA GMRGLGKAPHSGEGHERGRGNSKMKACNNYQYGYLAKPDTSFWIKCRRWLLADAGRHTQRPFWTFRVSHSPLLEAE AGRPSDVSQLQLGSDLKPKMRRPAGELFSPKDAGWELDPAEKSE
GeneID:
403312
Add. information Mouse polyclonal antibody raised against a full-length human MGC39545 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn