nicht mehr verfügbar

H00004282-D01P MIF Antikörper

See related secondary antibodies

Search for all "MIF"

Kurzübersicht

Rabbit anti Human MIF

H00004282-D01P

Mehr Bilder

  • H00004282-D01P
  • H00004282-D01P

Produktbeschreibung für MIF

Rabbit anti Human MIF.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Produktdaten von MIF

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 mg
Synonyme GLIF, Glycosylation-inhibiting factor, MMIF, Macrophage migration inhibitory factor, Phenylpyruvate tautomerase
Präsentation Purified
Reaktivität Hu
Anwendungen E(detection), WB
Klonalität Polyclonal
Wirt Rabbit
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P14174
Immunogen:
MIF (NP_002406.1, 1 a.a. ~ 115 a.a) full-length human protein.
AA Sequence:
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSY SKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
GeneID:
4282
Remarks:
Gene Accession: NM_002415
Add. information Rabbit polyclonal antibody raised against a full-length human MIF protein.

Antibody reactive against mammalian transfected lysate.
Anwendung Det Ab,WB-Ce,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 4282

Accessory Products

Proteins and/or Positive Controls

Proteine zu MIF (15 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

MIF

MIF Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 438,00 €
  OriGene Technologies, Inc.

MIF

MIF Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
25 µg / 139,00 €
  OriGene Technologies, Inc.

MIF (1-115)

MIF Human Purified > 98 % pure by SDS PAGE E. coli
0.5 mg / 990,00 €
  Acris Antibodies GmbH

MIF (1-115)

MIF Human Purified > 98 % pure by SDS PAGE E. coli
0.1 mg / 340,00 €
  Acris Antibodies GmbH

MIF (1-115, His-tag)

MIF Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / 730,00 €
  Acris Antibodies GmbH

MIF (1-115, His-tag)

MIF Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / 300,00 €
  Acris Antibodies GmbH

MIF (1-115, His-tag)

MIF Human Purified > 95 % by SDS-PAGE E. coli
0.1 mg / 230,00 €
  Acris Antibodies GmbH

MIF (1-115, His-tag)

MIF Human Purified > 95 % by SDS-PAGE E. coli
0.5 mg / 540,00 €
  Acris Antibodies GmbH

MIF

MIF Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MIF

MIF Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MIF

MIF Human
  Abnova Taiwan Corp.

MIF

MIF Human Purified > 95 % E. coli
5 µg / 190,00 €
  Neuromics Antibodies

MIF

MIF Human Purified > 95 % E. coli
25 µg / 290,00 €
  Neuromics Antibodies

MIF

MIF Human Purified
  Novus Biologicals Inc.

MIF

MIF Human Purified
  Novus Biologicals Inc.

Positive controls for MIF (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

MIF Lysate

Western Blot: MIF Lysate [NBL1-13108] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MIF
  Novus Biologicals Inc.
  • LinkedIn