TA337663 MIF Antikörper

Rabbit Polyclonal Anti-MIF Antibody

See related secondary antibodies

Search for all "MIF"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, Sheep MIF

Produktbeschreibung für MIF

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat, Sheep MIF.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von MIF

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme GLIF, Glycosylation-inhibiting factor, MMIF, Macrophage migration inhibitory factor, Phenylpyruvate tautomerase
Präsentation Purified
Reaktivität Bov, Can, Hu, Ms, Por, Rt, Sh
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P14174
Immunogen:
The immunogen for anti-MIF antibody: synthetic peptide directed towards the middle region of human MIF. Synthetic peptide located within the following region: PQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLL.
GeneID:
4282
Anwendung WB
Background This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additiol role in integrin sigling pathways.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu MIF (15 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

MIF

MIF Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

MIF

MIF Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
25 µg / 230,00 €
  OriGene Technologies, Inc.

MIF (1-115)

MIF Human Purified > 98 % pure by SDS PAGE E. coli
0.5 mg / 1.070,00 €
  OriGene Technologies GmbH

MIF (1-115)

MIF Human Purified > 98 % pure by SDS PAGE E. coli
0.1 mg / 400,00 €
  OriGene Technologies GmbH

MIF (1-115, His-tag)

MIF Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / 820,00 €
  OriGene Technologies GmbH

MIF (1-115, His-tag)

MIF Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / 320,00 €
  OriGene Technologies GmbH

MIF (1-115, His-tag)

MIF Human Purified > 95 % by SDS-PAGE E. coli
0.1 mg / 250,00 €
  OriGene Technologies GmbH

MIF (1-115, His-tag)

MIF Human Purified > 95 % by SDS-PAGE E. coli
0.5 mg / 600,00 €
  OriGene Technologies GmbH

MIF

MIF Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MIF

MIF Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MIF

MIF Human
  Abnova Taiwan Corp.

MIF

MIF Human Purified > 95 % E. coli
5 µg / 190,00 €
  Neuromics Antibodies

MIF

MIF Human Purified > 95 % E. coli
25 µg / 290,00 €
  Neuromics Antibodies

MIF

MIF Human Purified
  Novus Biologicals Inc.

MIF

MIF Human Purified
  Novus Biologicals Inc.

Positive controls for MIF (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

MIF Lysate

Western Blot: MIF Lysate [NBL1-13108] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MIF
  Novus Biologicals Inc.
  • LinkedIn