nicht mehr verfügbar

H00004318-M03 MMP-9 Antikörper

See related secondary antibodies

Search for all "MMP-9"

Kurzübersicht

Mouse anti Human MMP-9 2H4

H00004318-M03

Mehr Bilder

  • H00004318-M03

Produktbeschreibung für MMP-9

Mouse anti Human MMP-9 2H4.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Produktdaten von MMP-9

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 mg
Synonyme 92 kDa gelatinase, 92 kDa type IV collagenase, CLG4B, GELB, Gelatinase B, MMP9, Matrix metalloproteinase-9
Präsentation Purified
Reaktivität Hu
Anwendungen E, ICC/IF, WB
Klonalität Monoclonal
Klon 2H4
Wirt Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P14780
Immunogen:
MMP9 (AAH06093, 1 a.a. ~ 708 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQK QLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVT PLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGA ACHFPFIFEGRSYSACTTDGRSDGLPW
GeneID:
4318
Remarks:
Gene Accession: BC006093
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full-length recombinant MMP9.

Antibody Reactive Against Recombinant Protein.
Anwendung ELISA,IF,PLA-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 4318
FocusOn and Reviews
Bewertungen:

Accessory Products

Proteins and/or Positive Controls

Proteine zu MMP-9 (7 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

MMP-9

MMP-9 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.

MMP-9

MMP-9 Human > 95 % pure by SDS-PAGE: This preparation is free from gelatinase B dimers and from complexes of gelatinase B with TIMP-1 or lipocalin. Blood
  OriGene Technologies GmbH

MMP-9

MMP-9 Human
  Abnova Taiwan Corp.

MMP-9

MMP-9 Human Purified
  Abnova Taiwan Corp.

MMP-9

MMP-9 Human Purified
  Abnova Taiwan Corp.

MMP-9

MMP-9 Human
  Abnova Taiwan Corp.

MMP-9

MMP-9 Human
  Abnova Taiwan Corp.

Positive controls for MMP-9 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

MMP9 Lysate

Western Blot: MMP9 Lysate [NBL1-13162] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MMP9
  Novus Biologicals Inc.

MMP9 overexpression lysate

MMP9 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn