nicht mehr verfügbar

H00394263-B01P MUC21 Antikörper

See related secondary antibodies

Search for all "MUC21"

Kurzübersicht

Mouse anti Human MUC21

H00394263-B01P

Produktbeschreibung für MUC21

Mouse anti Human MUC21.
Product is tested for Western blot / Immunoblot.

Produktdaten von MUC21

Produkt-Kategorie Primärantikörper
Menge 0.5 mg
Synonyme C6orf205, KMQK697, MGC125609, bCX31G15.2
Reaktivität Hu
Anwendungen WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Worldwide
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q5SSG8
Immunogen:
MUC21 (NP_001010909.1, 1 a.a. ~ 566 a.a) full-length human protein.
AA Sequence:
MKMQKGNVLLMFGLLLHLEAATNSNETSTSANTGSSVISSGASTATNSGSSVTSSGVSTATISGSSVTSNGVSIVT NSEFHTTSSGISTATNSEFSTASSGISIATNSESSTTSSGASTATNSESSTPSSGASTATNSDSSTTSSGASTATN SDSSTTSSEASTATNSESSTTSSGASTATNSESSTVSSRASTATNSESSTTSSGASTATNSESRTTSNGAGTATNS ESSTTSSGASTATNSESSTPSSGAGTATNSESSTTSSGAGTATNSESSTVSSGISTVTNSESSTPSSGANTATNSE SSTTSSGANTATNSDSSTTSSGASTATNSESSTTSSGASTATNSESSTTSSGASTATNSGSSTTSSGTSTATNSES STVSSGASTATTSESSTTSSGASTATNSESSTVSSGASTATNSESSTTSSGANTATNSGSSVTSAGSGTAALTGMH TTSHSASTAVSEAKPGGSLVPWEIFLITLVSVVAAVGLFAGLFFCVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGG NHGAPHRPRWSPNWFWRRPVSSIAMEMSGRNSGP
GeneID:
394263
Add. information Mouse polyclonal antibody raised against a full-length human MUC21 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn