nicht mehr verfügbar

NBP1-94167 MYEOV2 Antikörper

See related secondary antibodies

Search for all "MYEOV2"

Kurzübersicht

Rabbit anti Human MYEOV2

Produktbeschreibung für MYEOV2

Rabbit anti Human MYEOV2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Produktdaten von MYEOV2

Produkt-Kategorie Primärantikörper
Menge 0.1 ml
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen P
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q8WXC6
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ATSEGKMGTGRLRNSLRKNQSKWLGSYLEVLRTTRSRREVSEDSTISVSTHWRGKCFKSDETPSVAGGEEGKKTTQPC
GeneID:
150678
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 150678

Accessory Products

  • LinkedIn