nicht mehr verfügbar

NBP1-90522 NOL11 Antikörper

See related secondary antibodies

Search for all "NOL11"

Kurzübersicht

Rabbit anti Human NOL11

NBP1-90522

Mehr Bilder

  • NBP1-90522
  • NBP1-90522

Produktbeschreibung für NOL11

Rabbit anti Human NOL11.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Produktdaten von NOL11

Produkt-Kategorie Primärantikörper
Menge 0.1 ml
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen ICC/IF, P, WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q9H8H0
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: FTLSSVVLSAGPEGLLGVEQSDKTDQFLVTDSGRTVILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGEYVVVHDNKVLRIWNNEDVNL
GeneID:
25926
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 26005

Accessory Products

  • LinkedIn