nicht mehr verfügbar

H00408050-M03 NOMO3 Antikörper

See related secondary antibodies

Search for all "NOMO3"

Kurzübersicht

Mouse anti Human NOMO3 5A7

H00408050-M03

Produktbeschreibung für NOMO3

Mouse anti Human NOMO3 5A7.
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Produktdaten von NOMO3

Produkt-Kategorie Primärantikörper
Menge 0.1 mg
Synonyme Nomo
Reaktivität Hu
Anwendungen E, WB
Klonalität Monoclonal
Klon 5A7
Wirt Mouse
Isotype IgG2a
Shipping to Worldwide
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P69849
Immunogen:
NOMO3 (NP_001004067.1, 966 a.a. ~ 1033 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
TVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHH
GeneID:
408050
Add. information Mouse monoclonal antibody raised against a partial recombinant NOMO3.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody Reactive Against Recombinant Protein.

Accessory Products

Proteins and/or Positive Controls

Proteine zu NOMO3 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

NODAL modulator 3 (NOMO3)

NODAL modulator 3 (NOMO3) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.
  • LinkedIn