nicht mehr verfügbar

H00010215-M03 OLIG2 Antikörper

See related secondary antibodies

Search for all "OLIG2"

Kurzübersicht

Mouse anti Human OLIG2 3C9

Produktbeschreibung für OLIG2

Mouse anti Human OLIG2 3C9.
Presentation: Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Produktdaten von OLIG2

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 mg
Synonyme BHLHB1, Class B basic helix-loop-helix protein 1, OLIG2, Oligo2, Oligodendrocyte transcription factor 2, PRKCBP2, Protein kinase C-binding protein 2, Protein kinase C-binding protein RACK17, RACK17, bHLHB1
Präsentation Purified
Reaktivität Hu
Anwendungen E, ICC/IF, P, WB
Klonalität Monoclonal
Klon 3C9
Wirt Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q13516
Immunogen:
OLIG2 (NP_005797, 2 a.a. ~ 78 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
DSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKS S
GeneID:
10215
Remarks:
Gene Accession: NM_005806
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full length recombinant OLIG2.

Antibody Reactive Against Recombinant Protein.
Anwendung ELISA,IHC-P,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10215
FocusOn and Reviews
FocusOns:

Accessory Products

Proteins and/or Positive Controls

Proteine zu OLIG2 (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

OLIG2

OLIG2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 438,00 €
  OriGene Technologies, Inc.

OLIG2

OLIG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

OLIG2

OLIG2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for OLIG2 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

OLIG2 293T Cell Transient Overexpression Lysate(Denatured)

OLIG2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn