AM02142PU-S Parathyroid hormone / PTH (1-34) Antikörper

See related secondary antibodies

Search for all "Parathyroid hormone / PTH"

10 µg / 170,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rat anti Human Parathyroid hormone / PTH 3B3

AM02142PU-S

Produktbeschreibung für Parathyroid hormone / PTH

Rat anti Human Parathyroid hormone / PTH 3B3.
Properties: (1-34)
Presentation: Purified
Product is tested for Frozen Sections, Enzyme Immunoassay, Paraffin Sections.

Produktdaten von Parathyroid hormone / PTH

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 10 µg
Synonyme Parathormone, Parathyrin
Präsentation Purified
Reaktivität Hu
Anwendungen C, E, P
Klonalität Monoclonal
Klon 3B3
Wirt Rat
Isotype IgG2b
Shipping to Worldwide
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies GmbH
Material safety datasheet MSDS for Monoclonal Antibodies (de)

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P01270
Immunogen:
Synthetic Human PTH (aa 1-34) BSA conjugated.
AA Sequence:
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
GeneID:
5741
Eigenschaften 1-34
Add. information LocusID 5741
Anwendung ELISA. 
Immunoprecipitation (Affinity Chromatography)
 (Ref.1).
Immunohistochemistry on CryoSections and Paraffin-Sections:
1/25-50.
Background Parathyroid hormone (PTH), or Parathormone, is secreted by the parathyroid glands as a polypeptide containing 84 amino acids. It acts to increase the concentration of calcium in the blood, whereas calcitonin (a hormone produced by the parafollicular cells of the thyroid gland) acts to decrease calcium concentration.
General Readings
  1. Hocher B, Armbruster FP, Stoeva S, Reichetzeder C, Grön HJ, Lieker I, et al. Measuring parathyroid hormone (PTH) in patients with oxidative stress--do we need a fourth generation parathyroid hormone assay? PLoS One. 2012;7(7):e40242. doi: 10.1371/journal.pone.0040242. Epub 2012 Jul 6. PubMed PMID: 22792251. (Free PMC Article available, 8 images available)
  2. Logue FC, Perry B, Biggart EM, Chapman RS, Beastall GH. Production and characterisation of monoclonal antibodies to parathyroid hormone (1-34). J Immunol Methods. 1991 Mar 21;137(2):159-66. PubMed PMID: 2013695.
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Protein G Chromatography
Buffer System:
PBS, pH 7.4 without preservatives
State:
Lyophilized purified Cell supernatant
Purified
Reconstitution:
Restore in aqua bidest to 1 mg/ml.
Specificity
Specificity:
This antibody detects Human oxidized PTH (aa 1-34), native PTH in tissue sections and in circulation. 
Cross reacts with native PTH (aa 1-84).
Species:
Human.
Gene ID 5741

Accessory Products

Proteins and/or Positive Controls

Proteine zu Parathyroid hormone / PTH (25 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

Parathyroid hormone / PTH

Parathyroid hormone / PTH Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / 299,00 €
  OriGene Technologies, Inc.

Parathyroid hormone / PTH (1-34)

Parathyroid hormone / PTH Human Purified > 98.0% as determined by RP-HPLC Synthetic
  OriGene Technologies GmbH

Parathyroid hormone / PTH (1-34)

Parathyroid hormone / PTH Human Purified > 98.0% as determined by RP-HPLC Synthetic
  OriGene Technologies GmbH

Parathyroid hormone / PTH (1-34)

Parathyroid hormone / PTH Human Purified > 98.0% as determined by RP-HPLC Synthetic
  OriGene Technologies GmbH

Parathyroid hormone / PTH (1-84)

Parathyroid hormone / PTH Human Purified > 95.0% as determined by both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

Parathyroid hormone / PTH (1-84)

Parathyroid hormone / PTH Human Purified > 95.0% as determined by both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

Parathyroid hormone / PTH (1-84)

Parathyroid hormone / PTH Human Purified > 95.0% as determined by both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

Parathyroid hormone / PTH (1-34)

Parathyroid hormone / PTH Human Purified >98.0% as determined by by both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

Parathyroid hormone / PTH (1-34)

Parathyroid hormone / PTH Human Purified >98.0% as determined by by both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

Parathyroid hormone / PTH (1-34)

Parathyroid hormone / PTH Human Purified >98.0% as determined by by both RP-HPLC and SDS-PAGE analysis E. coli
  OriGene Technologies GmbH

Parathyroid hormone / PTH (32-115)

Parathyroid hormone / PTH Human Purified > 95 % by SDS - PAGE E. coli
50 µg / 320,00 €
  OriGene Technologies GmbH

Parathyroid hormone / PTH (32-115)

Parathyroid hormone / PTH Human Purified > 95 % by SDS - PAGE E. coli
10 µg / 150,00 €
  OriGene Technologies GmbH

Parathyroid hormone / PTH (1-34)

Precursor- Protein structure and amino acid sequence Human Purified > 98 % Greater than 98.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by reducing and non-reducing SDS-PAGE
E. coli
  OriGene Technologies GmbH

Parathyroid hormone / PTH (1-34)

Precursor- Protein structure and amino acid sequence Human Purified > 98 % Greater than 98.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by reducing and non-reducing SDS-PAGE
E. coli
  OriGene Technologies GmbH

Parathyroid hormone / PTH (1-34)

Precursor- Protein structure and amino acid sequence Human Purified > 98 % Greater than 98.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by reducing and non-reducing SDS-PAGE
E. coli
  OriGene Technologies GmbH

Parathyroid hormone / PTH (32-115)

Parathyroid hormone / PTH Human Purified > 95 % by SDS-PAGE E. coli
0.1 mg / 250,00 €
  OriGene Technologies GmbH

Parathyroid hormone / PTH (32-115)

Parathyroid hormone / PTH Human Purified > 95 % by SDS-PAGE E. coli
0.5 mg / 600,00 €
  OriGene Technologies GmbH

Parathyroid hormone / PTH

Parathyroid hormone / PTH Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Parathyroid hormone / PTH

Parathyroid hormone / PTH Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Parathyroid hormone / PTH

Parathyroid hormone / PTH Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Parathyroid hormone / PTH

Parathyroid hormone / PTH Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Parathyroid hormone / PTH

Parathyroid hormone / PTH Human
  Abnova Taiwan Corp.

Parathyroid hormone / PTH (1-34)

Parathyroid hormone / PTH Human > 98 % E. coli
  QED Bioscience Inc.

Parathyroid hormone / PTH (1-34)

Parathyroid hormone / PTH Human > 98 % E. coli
  QED Bioscience Inc.

Parathyroid hormone / PTH (1-34)

Parathyroid hormone / PTH Human > 98 % E. coli
  QED Bioscience Inc.

Positive controls for Parathyroid hormone / PTH (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

PTH overexpression lysate

PTH overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn