TA346623 PGCP Antikörper

Rabbit Polyclonal Anti-PGCP Antibody

See related secondary antibodies

Search for all "PGCP"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PGCP

Produktbeschreibung für PGCP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PGCP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von PGCP

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme Plasma glutamate carboxypeptidase
Präsentation Purified
Reaktivität Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q9Y646
Immunogen:
The immunogen for anti-PGCP antibody: synthetic peptide directed towards the N terminal of human PGCP. Synthetic peptide located within the following region: VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA.
GeneID:
10404
Anwendung WB
Background This gene encodes a metallopeptidase that belongs to the peptidase M28 family. The encoded protein may catalyze the cleavage of dipeptides with unsubstituted terminals into amino acids. [provided by RefSeq, Jul 2013].
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu PGCP (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

PGCP

PGCP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PGCP

PGCP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PGCP (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

PGCP 293T Cell Transient Overexpression Lysate(Denatured)

PGCP 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PGCP Lysate

Western Blot: PGCP Lysate [NBL1-14328] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for PGCP.
  Novus Biologicals Inc.
  • LinkedIn