TA342483 PHF5A Antikörper

Rabbit Polyclonal Anti-PHF5A Antibody

See related secondary antibodies

Search for all "PHF5A"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PHF5A

Produktbeschreibung für PHF5A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PHF5A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von PHF5A

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme PHD finger-like domain-containing protein 5A, SF3b14b, Splicing factor 3B-associated 14 kDa protein
Präsentation Purified
Reaktivität Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ze
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q7RTV0
Immunogen:
The immunogen for anti-PHF5A antibody: synthetic peptide directed towards the middle region of human PHF5A. Synthetic peptide located within the following region: ICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK.
GeneID:
84844
Anwendung WB
Background This gene encodes a subunit of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S R unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mR upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mR. The protein encoded by this gene contains a PHD-finger-like domain that is flanked by highly basic N- and C-termini. This protein belongs to the PHD-finger superfamily and may act as a chromatin-associated protein. This gene has several pseudogenes on different chromosomes. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 231% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu PHF5A (8 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

PHF5A (1-110, His-tag)

PHF5A Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / 820,00 €
  OriGene Technologies GmbH

PHF5A (1-110, His-tag)

PHF5A Human Purified > 85 % by SDS - PAGE E. coli
20 µg / 320,00 €
  OriGene Technologies GmbH

PHF5A

PHF5A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PHF5A

PHF5A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PHF5A

PHF5A Human
  Abnova Taiwan Corp.

PHF5A

PHF5A Human
  Abnova Taiwan Corp.

PHF5A

PHF5A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PHF5A

PHF5A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PHF5A (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

PHF5A Lysate

Western Blot: PHF5A Lysate [NBL1-14360] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PHF5A
  Novus Biologicals Inc.
  • LinkedIn