nicht mehr verfügbar

NBP1-90721 PLAC8 Antikörper

See related secondary antibodies

Search for all "PLAC8"

Kurzübersicht

Rabbit anti Human PLAC8

NBP1-90721

Mehr Bilder

  • NBP1-90721

Produktbeschreibung für PLAC8

Rabbit anti Human PLAC8.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Produktdaten von PLAC8

Produkt-Kategorie Primärantikörper
Menge 0.1 ml
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen P, WB
Klonalität Polyclonal
Wirt Rabbit
Shipping to Not USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q9NZF1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF
GeneID:
51316
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 51316

Accessory Products

Proteins and/or Positive Controls

Proteine zu PLAC8 (4 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

PLAC8 (1-115, His-tag)

PLAC8 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / 730,00 €
  OriGene Technologies GmbH

PLAC8 (1-115, His-tag)

PLAC8 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / 300,00 €
  OriGene Technologies GmbH

Placenta-specific 8 (PLAC8), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug (full length, N-term HIS tag, transcript variant 2)

Placenta-specific 8 (PLAC8), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / 199,00 €
  OriGene Technologies, Inc.

Placenta-specific 8 (PLAC8), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug (full length, N-term HIS tag, transcript variant 3)

Placenta-specific 8 (PLAC8), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / 199,00 €
  OriGene Technologies, Inc.
  • LinkedIn