TA334357 PTCD3 Antikörper

Rabbit Polyclonal Anti-PTCD3 Antibody

See related secondary antibodies

Search for all "PTCD3"

50 µg / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.


Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat PTCD3

Produktbeschreibung für PTCD3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat PTCD3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von PTCD3

Produkt-Kategorie Primärantikörper
Menge 50 µg
Synonyme Pentatricopeptide repeat-containing protein 3 mitochondrial, TRG-15, TRG15, Transformation-related gene 15 protein
Präsentation Purified
Reaktivität Bov, Can, Eq, GP, Hu, Rb, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.


Swiss Prot Num:
The immunogen for anti-PTCD3 antibody is: synthetic peptide directed towards the C-terminal region of Human PTCD3. Synthetic peptide located within the following region: LEVIPKIWKDSKEYGHTFRSDLREEILMLMARDKHPPELQVAFADCAADI.
Anwendung WB
Background Mitochondrial R-binding protein that has a role in mitochondrial translation.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteine zu PTCD3 (3 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  


PTCD3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 748,00 €
  OriGene Technologies, Inc.


PTCD3 Human Purified
  Abnova Taiwan Corp.


PTCD3 Human Purified
  Abnova Taiwan Corp.

Positive controls for PTCD3 (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

PTCD3 Lysate

Western Blot: PTCD3 Lysate [NBL1-14923] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PTCD3
  Novus Biologicals Inc.

PTCD3 overexpression lysate

PTCD3 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn