nicht mehr verfügbar

H00005778-D01P PTPN7 / HEPTP Antikörper

See related secondary antibodies

Search for all "PTPN7 / HEPTP"

Kurzübersicht

Rabbit anti Human PTPN7 / HEPTP

H00005778-D01P

Mehr Bilder

  • H00005778-D01P

Produktbeschreibung für PTPN7 / HEPTP

Rabbit anti Human PTPN7 / HEPTP.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Produktdaten von PTPN7 / HEPTP

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 mg
Synonyme Hematopoietic protein-tyrosine phosphatase, Protein-tyrosine phosphatase LC-PTP, Tyrosine-protein phosphatase non-receptor type 7
Präsentation Purified
Reaktivität Hu
Anwendungen E(detection), WB
Klonalität Polyclonal
Wirt Rabbit
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P35236
Immunogen:
PTPN7 (NP_002823.2, 1 a.a. ~ 360 a.a) full-length human protein.
AA Sequence:
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLR TAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINA NYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKEC PEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIAT RIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
GeneID:
5778
Remarks:
Gene Accession: NM_002832.2
Add. information Rabbit polyclonal antibody raised against a full-length human PTPN7 protein.

Antibody reactive against mammalian transfected lysate.
Anwendung Det Ab,PLA-Ce,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 5778

Accessory Products

Proteins and/or Positive Controls

Proteine zu PTPN7 / HEPTP (7 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

PTPN7 / HEPTP (transcript variant 1)

PTPN7 / HEPTP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

PTPN7 / HEPTP (transcript variant 2)

PTPN7 / HEPTP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 438,00 €
  OriGene Technologies, Inc.

PTPN7 / HEPTP

PTPN7 / HEPTP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PTPN7 / HEPTP

PTPN7 / HEPTP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PTPN7 / HEPTP

PTPN7 / HEPTP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PTPN7 / HEPTP

PTPN7 / HEPTP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PTPN7 / HEPTP

PTPN7 / HEPTP Human
  Abnova Taiwan Corp.

Positive controls for PTPN7 / HEPTP (4 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PTPN7 Lysate

Western Blot: PTPN7 Lysate [NBL1-14977] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PTPN7
  Novus Biologicals Inc.

PTPN7 Lysate

Western Blot: PTPN7 Lysate [NBL1-14978] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PTPN7
  Novus Biologicals Inc.
  • LinkedIn