TA343182 PTPN7 / HEPTP Antikörper

Rabbit Polyclonal Anti-PTPN7 Antibody

See related secondary antibodies

Search for all "PTPN7 / HEPTP"

50 µg / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.


Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PTPN7 / HEPTP

Produktbeschreibung für PTPN7 / HEPTP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PTPN7 / HEPTP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von PTPN7 / HEPTP

Produkt-Kategorie Primärantikörper
Menge 50 µg
Synonyme Hematopoietic protein-tyrosine phosphatase, Protein-tyrosine phosphatase LC-PTP, Tyrosine-protein phosphatase non-receptor type 7
Präsentation Purified
Reaktivität Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.


Swiss Prot Num:
The immunogen for anti-Ptpn7 antibody is: synthetic peptide directed towards the middle region of Rat Ptpn7. Synthetic peptide located within the following region: GPMPNTVADFWEMVWQEDVSLIVMLTQLREGKEKCVHYWPTEEEAYGPFQ.
Anwendung WB
Background Tyrosine phosphatase found in T cells, B cells and mast cells.
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 942% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteine zu PTPN7 / HEPTP (7 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

PTPN7 / HEPTP (transcript variant 1)

PTPN7 / HEPTP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

PTPN7 / HEPTP (transcript variant 2)

PTPN7 / HEPTP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 438,00 €
  OriGene Technologies, Inc.


PTPN7 / HEPTP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


PTPN7 / HEPTP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


PTPN7 / HEPTP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


PTPN7 / HEPTP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


  Abnova Taiwan Corp.

Positive controls for PTPN7 / HEPTP (4 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)

PTPN7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PTPN7 Lysate

Western Blot: PTPN7 Lysate [NBL1-14977] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PTPN7
  Novus Biologicals Inc.

PTPN7 Lysate

Western Blot: PTPN7 Lysate [NBL1-14978] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PTPN7
  Novus Biologicals Inc.
  • LinkedIn