nicht mehr verfügbar

H00006418-M01 SET / I2PP2A Antikörper

See related secondary antibodies

Search for all "SET / I2PP2A"

Kurzübersicht

Mouse anti Human SET / I2PP2A M1-F5

Produktbeschreibung für SET / I2PP2A

Mouse anti Human SET / I2PP2A M1-F5.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Produktdaten von SET / I2PP2A

Produkt-Kategorie Primärantikörper
Menge 0.1 mg
Synonyme I-2PP2A, IGAAD, Inhibitor of granzyme A-activated DNase, PHAPII, Phosphatase 2A inhibitor I2PP2A, TAF-I, Template-activating factor I
Präsentation Purified
Reaktivität Hu
Anwendungen E, WB
Klonalität Monoclonal
Klon M1-F5
Wirt Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
H0UI37
Immunogen:
SET (AAH32749, 1 a.a. ~ 278 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIA KIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPS SKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDE EGEGEEDDDDDEEEEGLEDIDEEGDED
GeneID:
100130890
Remarks:
Gene Accession: BC032749
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full length recombinant SET.

Antibody Reactive Against Recombinant Protein.
Anwendung ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 6418

Accessory Products

Proteins and/or Positive Controls

Proteine zu SET / I2PP2A (6 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

SET (1-290, His-tag)

SET Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / 730,00 €
  OriGene Technologies GmbH

SET (1-290, His-tag)

SET Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / 300,00 €
  OriGene Technologies GmbH

SET / I2PP2A

SET / I2PP2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SET / I2PP2A

SET / I2PP2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TSTD3 (1-97, His-tag)

TSTD3 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / 940,00 €
  OriGene Technologies GmbH

TSTD3 (1-97, His-tag)

TSTD3 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / 370,00 €
  OriGene Technologies GmbH

Positive controls for SET / I2PP2A (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

SET Lysate

Western Blot: SET Lysate [NBL1-15867] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SET
  Novus Biologicals Inc.

TSTD3 overexpression lysate

TSTD3 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn