nicht mehr verfügbar

NBP1-52833 SIRT5 Antikörper

See related secondary antibodies

Search for all "SIRT5"

Kurzübersicht

Rabbit anti Human SIRT5

NBP1-52833

Produktbeschreibung für SIRT5

Rabbit anti Human SIRT5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von SIRT5

Produkt-Kategorie Primärantikörper
Menge 0.1 mg
Präsentation Purified
Reaktivität Hu
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Shipping to Europe only
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q5T295
Immunogen:
Synthetic peptides corresponding to SIRT5 (sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)) The peptide sequence was selected from the C terminal of SIRT5 . Peptide sequence HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAE
GeneID:
23408
Background SIRT5 is included in class III of the sirtuin family which ischaracterized by a sirtuin core domain. Human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified
Gene ID 23408

Accessory Products

  • LinkedIn