nicht mehr verfügbar

H00011039-B02 SMA3 / SMA4 MaxPab mouse Antikörper

See related secondary antibodies

Search for all "SMA3 / SMA4 MaxPab mouse"

Kurzübersicht

Mouse anti Human SMA3 / SMA4 MaxPab mouse

Produktbeschreibung für SMA3 / SMA4 MaxPab mouse

Mouse anti Human SMA3 / SMA4 MaxPab mouse.
Product is tested for ELISA (detection), Western blot / Immunoblot.

Produktdaten von SMA3 / SMA4 MaxPab mouse

Produkt-Kategorie Primärantikörper
Menge 50 µl
Synonyme FLJ36702, FLJ39772, MGC22265, MGC60382, b55C20.2, glucuronidase beta pseudogene
Reaktivität Hu
Anwendungen E(detection), WB
Klonalität Polyclonal
Wirt Mouse
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Immunogen:
SMA4 (-, 1 a.a. ~ 140 a.a) full-length human protein.
AA Sequence:
MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHEHPAYLY SWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV
Remarks:
Gene Accession: BC002622
Add. information Mouse polyclonal antibody raised against a full-length human SMA4 protein.

Antibody reactive against mammalian transfected lysate.
Anwendung Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Purity:
Antibody reactive against mammalian transfected lysate.
Specificity
Species:
Human

Accessory Products

  • LinkedIn