nicht mehr verfügbar

NBP1-69515 Sodium-Calcium Exchanger Antikörper

See related secondary antibodies

Search for all "Sodium-Calcium Exchanger"

Kurzübersicht

Rabbit anti Human, Mouse, Rat Sodium-Calcium Exchanger

Produktbeschreibung für Sodium-Calcium Exchanger

Rabbit anti Human, Mouse, Rat Sodium-Calcium Exchanger.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von Sodium-Calcium Exchanger

Produkt-Kategorie Primärantikörper
Menge 50 µg
Präsentation Aff - Purified
Reaktivität Hu, Ms, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Shipping to Europe only
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q96QG2
Immunogen:
Synthetic peptides corresponding to SLC8A3(solute carrier family 8 (sodium-calcium exchanger), member 3) The peptide sequence was selected from the N terminal of SLC8A3. Peptide sequence SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE.
GeneID:
6547
Background SLC8A3 is a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner.This gene encodes a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner. Alternative splicing has been observed for this gene and multiple variants have been described.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 6547

Accessory Products

  • LinkedIn