nicht mehr verfügbar

NBP1-59813 Sodium Potassium ATPase Beta 1 Antikörper

See related secondary antibodies

Search for all "Sodium Potassium ATPase Beta 1"

Kurzübersicht

Rabbit anti Human Sodium Potassium ATPase Beta 1

Produktbeschreibung für Sodium Potassium ATPase Beta 1

Rabbit anti Human Sodium Potassium ATPase Beta 1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von Sodium Potassium ATPase Beta 1

Produkt-Kategorie Primärantikörper
Menge 50 µg
Synonyme ATP1B, MGC1798
Präsentation Aff - Purified
Reaktivität Hu
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Shipping to Europe only
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
A6NGH2
Immunogen:
Synthetic peptides corresponding to ATP1B1(ATPase, Na+/K+ transporting, beta 1 polypeptide) The peptide sequence was selected from the N terminal of ATP1B1. Peptide sequence RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD.
Background ATP1B1 belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K io
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn