nicht mehr verfügbar

NBP1-59978 TMEM126B Antikörper

See related secondary antibodies

Search for all "TMEM126B"

Kurzübersicht

Rabbit anti Human TMEM126B

Produktbeschreibung für TMEM126B

Rabbit anti Human TMEM126B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von TMEM126B

Produkt-Kategorie Primärantikörper
Menge 0.1 mg
Präsentation Purified
Reaktivität Hu
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Shipping to Europe only
PDF datasheet Datenblatt ansehen
Hersteller Novus Biologicals Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
A8K535
Immunogen:
Synthetic peptides corresponding to TMEM126B(transmembrane protein 126B) The peptide sequence was selected from the middle region of TMEM126B. Peptide sequence VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC.
GeneID:
55863
Background The function remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified
Gene ID 55863

Accessory Products

  • LinkedIn