TA344912 TMLHE / TMLD Antikörper

Rabbit Polyclonal Anti-TMLHE Antibody - C-terminal region

See related secondary antibodies

Search for all "TMLHE / TMLD"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Human, Rat TMLHE / TMLD

Produktbeschreibung für TMLHE / TMLD

Rabbit anti Human, Rat TMLHE / TMLD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von TMLHE / TMLD

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme Epsilon-trimethyllysine 2-oxoglutarate dioxygenase, TML dioxygenase, TML hydroxylase, TML-alpha-ketoglutarate dioxygenase, TMLH, Trimethyllysine dioxygenase mitochondrial
Präsentation Purified
Reaktivität Hu, Rt
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q9NVH6
Immunogen:
The immunogen for Anti-Tmlhe antibody is: synthetic peptide directed towards the C-terminal region of Rat Tmlhe. Synthetic peptide located within the following region: ELWVKLKPGKVLFIDNWRVLHGRESFTGYRQLCGCYLTRDDVLNTARILG.
GeneID:
55217
Anwendung WB
Background Tmlhe is a first enzyme in the carnitine biosynthesis pathway and plays an important role in the transport of fatty acids across the inner mitochondrial membrane.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu TMLHE / TMLD (4 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

TMLHE / TMLD

TMLHE / TMLD Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TMLHE / TMLD

TMLHE / TMLD Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TMLHE / TMLD

TMLHE / TMLD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TMLHE / TMLD

TMLHE / TMLD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TMLHE / TMLD (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

TMLHE overexpression lysate

TMLHE overexpression lysate
0.1 mg / 495,00 €
  OriGene Technologies, Inc.
  • LinkedIn