nicht mehr verfügbar

H00007280-M04 TUBB2A Antikörper

See related secondary antibodies

Search for all "TUBB2A"

Kurzübersicht

Mouse anti Human, Mouse, Rat TUBB2A 3B2

H00007280-M04

Mehr Bilder

  • H00007280-M04
  • H00007280-M04
  • H00007280-M04
  • H00007280-M04
  • H00007280-M04

Produktbeschreibung für TUBB2A

Mouse anti Human, Mouse, Rat TUBB2A 3B2.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Produktdaten von TUBB2A

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 mg
Synonyme TUBB2, Tubulin beta-2A chain
Präsentation Purified
Reaktivität Hu, Ms, Rt
Anwendungen E, ICC/IF, P, WB
Klonalität Monoclonal
Klon 3B2
Wirt Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q13885
Immunogen:
TUBB2A (AAH01194, 1 a.a. ~ 446 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSV RSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLI SKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHL VSATMSGVTTCLRFPGQLNADLRKLAV
GeneID:
7280
Remarks:
Gene Accession: BC001194
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full-length recombinant TUBB2A.

Antibody Reactive Against Recombinant Protein.
Anwendung ELISA,IF,IHC-P,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse,Rat
Gene ID 7280

Accessory Products

Proteins and/or Positive Controls

Proteine zu TUBB2A (7 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TUBB2A (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

beta II Tubulin A Lysate

Western Blot: beta II Tubulin A Lysate [NBL1-17437]
  Novus Biologicals Inc.

TUBB (Tubulin beta chain) Lysate(Denatured)

TUBB (Tubulin beta chain) Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn