TA345669 TUBB2A Antikörper

Rabbit Polyclonal Anti-TUBB2A Antibody

See related secondary antibodies

Search for all "TUBB2A"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish TUBB2A

Produktbeschreibung für TUBB2A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish TUBB2A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von TUBB2A

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 ml
Synonyme TUBB2, Tubulin beta-2A chain
Präsentation Purified
Reaktivität Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q13885
Immunogen:
The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the N terminal of human TUBB2A. Synthetic peptide located within the following region: MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV.
GeneID:
7280
Anwendung WB
Background TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteine zu TUBB2A (7 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TUBB2A

TUBB2A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TUBB2A (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

beta II Tubulin A Lysate

Western Blot: beta II Tubulin A Lysate [NBL1-17437]
  Novus Biologicals Inc.

TUBB (Tubulin beta chain) Lysate(Denatured)

TUBB (Tubulin beta chain) Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn