nicht mehr verfügbar

H00007328-M01 UBE2H Antikörper

See related secondary antibodies

Search for all "UBE2H"

Kurzübersicht

Mouse anti Human UBE2H 3C4-1A2

H00007328-M01

Mehr Bilder

  • H00007328-M01
  • H00007328-M01
  • H00007328-M01

Produktbeschreibung für UBE2H

Mouse anti Human UBE2H 3C4-1A2.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Produktdaten von UBE2H

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 mg
Synonyme E2-20K, UBCH2, Ubiquitin carrier protein H, Ubiquitin-conjugating enzyme E2 H, Ubiquitin-protein ligase H
Präsentation Purified
Reaktivität Hu
Anwendungen E, ICC/IF, WB
Klonalität Monoclonal
Klon 3C4-1A2
Wirt Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P62256
Immunogen:
UBE2H (AAH06277, 1 a.a. ~ 184 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFH PNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEE ALKEQEEGTGDSSSESSMSDFSEDEAQDMEL*
GeneID:
7328
Remarks:
Gene Accession: BC006277
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full length recombinant UBE2H.

Antibody Reactive Against Recombinant Protein.
Anwendung ELISA,IF,S-ELISA,WB-Ce,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7328

Accessory Products

Proteins and/or Positive Controls

Proteine zu UBE2H (7 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

UBE2H (transcript variant 1)

UBE2H Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

UBE2H (transcript variant 2)

UBE2H Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / 680,00 €
  OriGene Technologies, Inc.

UBE2H (transcript variant 1)

UBE2H Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / 299,00 €
  OriGene Technologies, Inc.

UBE2H (1-183, His-tag)

UBE2H Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / 730,00 €
  OriGene Technologies GmbH

UBE2H (1-183, His-tag)

UBE2H Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / 300,00 €
  OriGene Technologies GmbH

UBE2H

UBE2H Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UBE2H

UBE2H Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for UBE2H (2 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

UBE2H Lysate

Western Blot: UBE2H Lysate [NBL1-17531] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for UBE2H.
  Novus Biologicals Inc.

UBE2H overexpression lysate

UBE2H overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn