TA344764 WDR35 Antikörper

Rabbit Polyclonal Anti-WDR35 Antibody

See related secondary antibodies

Search for all "WDR35"

0.1 ml / 360,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.


Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish WDR35

Produktbeschreibung für WDR35

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish WDR35.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Produktdaten von WDR35

Produkt-Kategorie Primärantikörper
Menge 0.1 ml
Synonyme IFT121, Intraflagellar transport protein 121 homolog, KIAA1336, WD repeat-containing protein 35
Präsentation Purified
Reaktivität Can, GP, Hu, Ms, Por, Rb, Rt, Ze
Anwendungen WB
Klonalität Polyclonal
Wirt Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies, Inc.


Swiss Prot Num:
The immunogen for anti-WDR35 antibody: synthetic peptide directed towards the N terminal of human WDR35. Synthetic peptide located within the following region: SGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS.
Anwendung WB
Background This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, sigl transduction, apoptosis, and gene regulation. Multiple altertively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Positive controls for WDR35 (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

WDR35 overexpression lysate

WDR35 overexpression lysate
0.1 mg / 295,00 €
  OriGene Technologies, Inc.
  • LinkedIn