nicht mehr verfügbar

H00007490-M01 WT1 / Wilms tumor protein Antikörper

See related secondary antibodies

Search for all "WT1 / Wilms tumor protein"

Kurzübersicht

Mouse anti Human WT1 / Wilms tumor protein 2H4

Produktbeschreibung für WT1 / Wilms tumor protein

Mouse anti Human WT1 / Wilms tumor protein 2H4.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Produktdaten von WT1 / Wilms tumor protein

Produkt-Kategorie Primärantikörper
Target-Kategorie
Menge 0.1 mg
Synonyme WT33
Präsentation Purified
Reaktivität Hu
Anwendungen E, WB
Klonalität Monoclonal
Klon 2H4
Wirt Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P19544
Immunogen:
WT1 (NP_000369, 349 a.a. ~ 439 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRH QRRHTGVKPFQCKTC
GeneID:
7490
Remarks:
Gene Accession: NM_000378
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a full length recombinant WT1.

Antibody Reactive Against Recombinant Protein.
Anwendung ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7490

Accessory Products

Proteins and/or Positive Controls

Proteine zu WT1 / Wilms tumor protein (7 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

WT1 / Wilms tumor protein (full length, N-term HIS tag, transcript variant B)

WT1 / Wilms tumor protein Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / 205,00 €
  OriGene Technologies, Inc.

WT1 / Wilms tumor protein (full length, N-term HIS tag, transcript variant A)

WT1 / Wilms tumor protein Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / 205,00 €
  OriGene Technologies, Inc.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for WT1 / Wilms tumor protein (1 Produkte)

Katalog-Nr. Spezies Präs. Reinheit   Source  

Wilms Tumor 1 Lysate

Western Blot: Wilms Tumor 1 Lysate [NBL1-17887] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for WT1
  Novus Biologicals Inc.
  • LinkedIn