nicht mehr verfügbar

H00023600-P01 AMACR / RACE

Search for all "AMACR / RACE"

Kurzübersicht

AMACR / RACE

H00023600-P01

Produktbeschreibung für AMACR / RACE

AMACR / RACE.

Produktdaten von AMACR / RACE

Produkt-Kategorie Proteins & Growth Factors
Target-Kategorie
Menge 2 µg
Synonyme 2-methylacyl-CoA racemase, Alpha-methylacyl-CoA racemase, P504S
Spezies (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
Q9UHK6
Add. information 12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Anwendung AP, Array, ELISA, WB-Re
Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Best use within three months from the date of receipt of this protein.
Beschreibung
AA Sequence:
MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVL LEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGS TSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn