nicht mehr verfügbar

P4426 MIF

Search for all "MIF"

Kurzübersicht

MIF

P4426

Produktbeschreibung für MIF

MIF.

Produktdaten von MIF

Produkt-Kategorie Proteins & Growth Factors
Menge 25 µg
Synonyme GIF, GLIF, MMIF
Spezies (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
I4AY87
Add. information 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Escherichia coli
Anwendung Func, SDS-PAGE
Storage Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Beschreibung
AA Sequence:
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSY SKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Format
Buffer System:
Lyophilized from 10 mM Na2PO4, pH 7.5.
State:
Lyophilized
  • LinkedIn