nicht mehr verfügbar

H00004318-P01 MMP-9

Search for all "MMP-9"

Kurzübersicht

MMP-9

H00004318-P01

Produktbeschreibung für MMP-9

MMP-9.

Produktdaten von MMP-9

Produkt-Kategorie Proteins & Growth Factors
Target-Kategorie
Menge 2 µg
Synonyme 92 kDa gelatinase, 92 kDa type IV collagenase, CLG4B, GELB, Gelatinase B, MMP9, Matrix metalloproteinase-9
Spezies (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P14780
Add. information 12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Anwendung AP, Array, ELISA, WB-Re
Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Best use within three months from the date of receipt of this protein.
Beschreibung
AA Sequence:
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQK QLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVT PLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGA ACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTT DGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFD SDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTT TTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLY LFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGA DVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSS RSELNQVDQVGYVTYDILQCPED
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn