nicht mehr verfügbar

H00653650-Q01-10 PDPK2

Search for all "PDPK2"

Kurzübersicht

PDPK2

H00653650-Q01-10

Produktbeschreibung für PDPK2

PDPK2.

Produktdaten von PDPK2

Produkt-Kategorie Proteins & Growth Factors
Menge 10 µg
Synonyme -
Spezies (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Add. information 12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Anwendung AP, Array, ELISA, WB-Re
Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Best use within three months from the date of receipt of this protein.
Beschreibung
AA Sequence:
PPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTP PKLTAYLPAMSEDDEDCYGN
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn