AR31125PU-N (Pro3) Gastric inhibitory polypeptide

Search for all "(Pro3) Gastric inhibitory polypeptide"

0.5 mg / 450,00 €
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Kurzübersicht

(Pro3) Gastric inhibitory polypeptide

AR31125PU-N

Produktbeschreibung für (Pro3) Gastric inhibitory polypeptide

(Pro3) Gastric inhibitory polypeptide.

Produktdaten von (Pro3) Gastric inhibitory polypeptide

Produkt-Kategorie Proteins & Growth Factors
Target-Kategorie
Menge 0.5 mg
Synonyme GIP, Glucose-dependent insulinotropic polypeptide
Molecular weight 4951.57 Da
Spezies (Protein) Human
Shipping to Worldwide
PDF datasheet Datenblatt ansehen
Hersteller OriGene Technologies GmbH
Material safety datasheet MSDS for Proteins (de)

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P09681
Reinheit > 95 % by HPLC
Anwendung Bioactivity
Background The gastric inhibitory peptide (GIP) is a potent stimulator of insulin secretion and poor inhibitor of gastric acid secretion.
Storage Upon receipt, store undiluted (in aliquots) at -20°C.
Avoid repeated freezing and thawing.
Shelf life: One year from despatch.
Beschreibung
Description:
Human (Pro3) Gastric Inhibitory Peptide (GIP).
Formula: C226H338N60O66S
AA Sequence:
YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH (1-letter code).
Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH (3-letter code).
Format
Purity:
>95% by HPLC
State:
Purified peptide
  • LinkedIn