nicht mehr verfügbar

P6015 sspA (Staphylococcus aureus)

Search for all "sspA (Staphylococcus aureus)"

Kurzübersicht

sspA (Staphylococcus aureus)

P6015

Produktbeschreibung für sspA (Staphylococcus aureus)

sspA (Staphylococcus aureus).

Produktdaten von sspA (Staphylococcus aureus)

Produkt-Kategorie Proteins & Growth Factors
Menge 50 µg
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P09332
Add. information Escherichia coli
Anwendung Func, SDS-PAGE
Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Beschreibung
AA Sequence:
LPNNDRHQITDTTNGHYAPVTYIQVEAPTGTFIASGVVVGKDTLLTNKHVVDATHGDPHALKAFPSAINQDNYPNG GFTAEQITKYSGEGDLAIVKFSPNEQNKHIGEVVKPATMSNNAETQVNQNITVTGYPGDKPVATMWESKGKITYLK GEAMQYDLSTTGGNSGSPVFNEKNEVIGIHWGGVPNEFNGAVFINENVRNFLKQNIEDIHFANDDQPNNPDNPDNP NNPDNPNNPDEPNNPDNPNNPDNPDNGDNNNSDNPDAA
Format
Buffer System:
Lyophilized from solutions contain no sodiun azide nor carrier protein.
State:
Lyophilized
  • LinkedIn