nicht mehr verfügbar

P6038 TIMP1

Search for all "TIMP1"

Kurzübersicht

TIMP1

P6038

Produktbeschreibung für TIMP1

TIMP1.

Produktdaten von TIMP1

Produkt-Kategorie Proteins & Growth Factors
Target-Kategorie
Menge 10 µg
Synonyme CLGI, EPA, Erythroid-potentiating activity, Fibroblast collagenase inhibitor, Metalloproteinase inhibitor 1, TIMP, TIMP-1, Tissue inhibitor of metalloproteinases
Spezies (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet Datenblatt ansehen
Hersteller Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datenblatt-Auszug

Immunogen
Swiss Prot Num:
P01033
Add. information Escherichia coli
Anwendung Func, SDS-PAGE
Storage Store at -20°C.
Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
Beschreibung
AA Sequence:
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRS HNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLL QGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
Format
Buffer System:
Lyophilized from sterile 10 mM Sodium Phosphate, pH 7.5.
State:
Lyophilized
  • LinkedIn